Protein Info for MMP_RS07645 in Methanococcus maripaludis S2

Annotation: aldehyde dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF00171: Aldedh" amino acids 11 to 460 (450 residues), 497.5 bits, see alignment E=1.7e-153

Best Hits

Swiss-Prot: 100% identical to LADH_METMP: Lactaldehyde dehydrogenase (MMP1487) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00131, glyceraldehyde-3-phosphate dehydrogenase (NADP) [EC: 1.2.1.9] (inferred from 100% identity to mmp:MMP1487)

MetaCyc: 57% identical to lactaldehyde dehydrogenase subunit (Methanocaldococcus jannaschii)
Lactaldehyde dehydrogenase. [EC: 1.2.1.22]

Predicted SEED Role

"L-lactaldehyde dehydrogenase (NAD) @ Propionaldehyde dehydrogenase (NAD) @ Glyceraldehyde dehydrogenase (NAD) @ Crotonaldehyde dehydrogenase (NAD)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.22 or 1.2.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX65 at UniProt or InterPro

Protein Sequence (465 amino acids)

>MMP_RS07645 aldehyde dehydrogenase family protein (Methanococcus maripaludis S2)
MFIDGKWIIREDIDVFDPYTLENIEKITALDREETKNAIEVTEKHKEIMKNLSPSKRYKI
LMKVAEHLSSKKDFFAKTISIDVGKPIKQSKIEVDRTLTALKLSAFYAKELRGETINSEN
GLIFTKKEPLGVIGAITPFNFPLNLATHKIGPAIATGNSVVLHPSSKAPIVAIYLTKIIE
HVLKQMDIPRGVFNLATGNGEIVGDEISKNDNVNMVSFTGSVEVGESISKNAKMKKVTLE
LGGNNPMIVLKDSDIKLAAKSAVKSKFLNAGQVCISVGQVLVEEEVVETFTKYVIEETKK
LILGNPLDKNTDIGPLISPESALRIENLIKQSVSEGGELLIGGNRQNSLISPAVINIDEE
NILSKIETFGPILPILTVKDSEEAVNIANNSKYGLQAGLFTNNINNAMKIADELEYGGIM
INSSPTFRKDNMPFGGVKKSGLGREGIKYTVEEMSETKTVVIHNI