Protein Info for MMP_RS07640 in Methanococcus maripaludis S2

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 14 to 47 (34 residues), 22.4 bits, see alignment 1.4e-08 PF00924: MS_channel_2nd" amino acids 100 to 167 (68 residues), 59 bits, see alignment E=6e-20 PF21082: MS_channel_3rd" amino acids 173 to 255 (83 residues), 61.1 bits, see alignment E=1.7e-20

Best Hits

Swiss-Prot: 31% identical to Y452_BUCAI: Uncharacterized MscS family protein BU452 (BU452) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1486)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX66 at UniProt or InterPro

Protein Sequence (267 amino acids)

>MMP_RS07640 mechanosensitive ion channel family protein (Methanococcus maripaludis S2)
MLISLMGYSMSINLILILKAILILVLGYFAVKIVSSILENGAKKSKIPELVSEFVIKLFS
AILYVFVILLAVGVFGVETGPIILGLSASLGLILGFGLQDTLTNLTSGLWIAVMKPLDKD
ETVQIGGITGKIVEVGIMATKLLTPDNVVITIPNKLVWGSPITNYTRMDLRRVDVAVGVS
YGENLDNALSKALELISEHPKVLKDPAPAVVVTGLGESSVDLQLRAWTKTGDYWGVKGDL
TKGIYEKYGKEGIEIPFPQMDIHVHKY