Protein Info for MMP_RS07630 in Methanococcus maripaludis S2

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR01166: cobalt ABC transporter, ATP-binding protein" amino acids 13 to 202 (190 residues), 283.2 bits, see alignment E=3.9e-89 PF00005: ABC_tran" amino acids 20 to 168 (149 residues), 112.3 bits, see alignment E=3e-36 PF13304: AAA_21" amino acids 136 to 201 (66 residues), 43.3 bits, see alignment E=4.6e-15

Best Hits

Swiss-Prot: 100% identical to ECFA_METMP: Energy-coupling factor transporter ATP-binding protein EcfA (ecfA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 100% identity to mmp:MMP1484)

MetaCyc: 44% identical to energy-coupling factor transporter ATP-bindind protein 2 (Clostridioides difficile 630)

Predicted SEED Role

"ATPase component CbiO of energizing module of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX68 at UniProt or InterPro

Protein Sequence (278 amino acids)

>MMP_RS07630 ATP-binding cassette domain-containing protein (Methanococcus maripaludis S2)
MAILETRDLKYSYPDGTVALNGINFKAEKGEMIAILGPNGAGKSTTFLHFNGILKPSNGS
VILKGEAIKYDNKSLLNVRKTVGIVFQNPDDQLFAPTVEQDVAFGPMNLGLSKEEIEKRV
KDSLKAVSMEGFERKPPHHLSGGQKKRIAIAGILAMNPEIIVLDEPTSGLDPMGASQIMK
LLYELNRQGITIIISTHDVDLVPIYANKVYLLNEGKIIKGGTPREIFSDSETVRSANLRL
PRVAHLIELLDKEDKLGIKMGYTIGEARNNIKEFIKGE