Protein Info for MMP_RS07575 in Methanococcus maripaludis S2

Annotation: RNA ligase partner protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR03875: RNA ligase partner, MJ_0950 family" amino acids 5 to 217 (213 residues), 294 bits, see alignment E=2.5e-92 PF08745: PIN_5" amino acids 5 to 217 (213 residues), 290.5 bits, see alignment E=3e-91

Best Hits

Swiss-Prot: 100% identical to Y1472_METMP: UPF0278 protein MMP1472 (MMP1472) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09006, hypothetical protein (inferred from 100% identity to mmp:MMP1472)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX80 at UniProt or InterPro

Protein Sequence (223 amino acids)

>MMP_RS07575 RNA ligase partner protein (Methanococcus maripaludis S2)
LQKQRFCLDTTAITDSDVRKSLGVSNISESAEKIMDIIAQARVQLDISCHIPYDTVYKEL
VGFLTREGCAPETLIKVDTWLVKKTPNRYEIKIPAEIFYEYIKDLRERINKGMRISENAM
YETALEAYILSKPDEKDREDVLNEVLSKTVNSFRVKYRNALRGGTLDSAPDLDVLLLAKE
LDAAVVANDEGIEKWAQRLGLRFVNARDFPFILQEYLDLWDKK