Protein Info for MMP_RS07535 in Methanococcus maripaludis S2

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00037: Fer4
  • amino acids 42 to 64 (23 residues), 31.2 bits, see alignment (E = 8.9e-11)
  • amino acids 73 to 94 (22 residues), 27.2 bits, see alignment (E = 1.7e-09)
  • amino acids 129 to 150 (22 residues), 32.2 bits, see alignment (E = 4.2e-11)
  • amino acids 158 to 180 (23 residues), 25.4 bits, see alignment (E = 5.9e-09)
  • amino acids 196 to 216 (21 residues), 27.2 bits, see alignment (E = 1.6e-09)
  • amino acids 225 to 245 (21 residues), 23.6 bits, see alignment (E = 2.2e-08)
• PF13237: Fer4_10
  • amino acids 42 to 90 (49 residues), 27.9 bits, 1.2e-09
  • amino acids 129 to 175 (47 residues), 28.7 bits, 7.1e-10
  • amino acids 158 to 212 (55 residues), 32.1 bits, E=6.1e-11
• PF14697: Fer4_21
  • amino acids 43 to 95 (53 residues), 39.1 bits, E=4.2e-13
  • amino acids 129 to 180 (52 residues), 38.6 bits, E=6.1e-13
• PF12800: Fer4_4
  • amino acids 46 to 60 (15 residues), 12.2 bits, see alignment (E = 0.00014)
  • amino acids 76 to 92 (17 residues), 14.4 bits, see alignment (E = 2.7e-05)
  • amino acids 132 to 146 (15 residues), 16.7 bits, see alignment (E = 4.9e-06)
  • amino acids 162 to 176 (15 residues), 15 bits, see alignment (E = 1.7e-05)
  • amino acids 199 to 214 (16 residues), 16.3 bits, see alignment (E = 6.5e-06)
• PF13187: Fer4_9
  • amino acids 47 to 94 (48 residues), 30.9 bits, 1.5e-10
  • amino acids 134 to 179 (46 residues), 31.9 bits, 7.2e-11
  • amino acids 164 to 216 (53 residues), 30.2 bits, E=2.4e-10
  • amino acids 201 to 245 (45 residues), 31 bits, 1.4e-10
• PF12838: Fer4_7
  • amino acids 47 to 93 (47 residues), 37.9 bits, 1.4e-12
  • amino acids 134 to 178 (45 residues), 38.9 bits, 6.3e-13
  • amino acids 164 to 215 (52 residues), 36.3 bits, E=4.1e-12
  • amino acids 200 to 244 (45 residues), 30.3 bits, 3e-10
• PF12798: Fer4_3
  • amino acids 48 to 62 (15 residues), 16.9 bits, see alignment (E = 5.9e-06)
  • amino acids 134 to 148 (15 residues), 13.3 bits, see alignment (E = 8.4e-05)
  • amino acids 164 to 178 (15 residues), 15.5 bits, see alignment (E = 1.7e-05)
  • amino acids 201 to 215 (15 residues), 16.8 bits, see alignment (E = 6.5e-06)
  • amino acids 230 to 244 (15 residues), 15.3 bits, see alignment (E = 2e-05)
• PF12837: Fer4_6
  • amino acids 72 to 94 (23 residues), 24.4 bits, see alignment (E = 1.4e-08)
• PF13534: Fer4_17
  • amino acids 78 to 146 (69 residues), 26.9 bits, E=3.6e-09

Best Hits

Swiss-Prot: 50% identical to Y514_METJA: Uncharacterized polyferredoxin-like protein MJ0514 (MJ0514) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1465)

Predicted SEED Role

"Energy conserving hydrogenase Eha associated polyferredoxin"

Sequence Analysis Tools

See Q6LX87 at UniProt or InterPro

Protein Sequence (252 amino acids)

>MMP_RS07535 4Fe-4S binding protein (Methanococcus maripaludis S2)
MITVKKPVQKIISDISKNLGIDEKFVKEKLKDLIVPVERNLYVESNKCIRCELCYEMCPV
DAIKEPSVKSPAEILPEKCVKCEICAKTCPVGAINVLEGRAKLEEDNVVYELKEIDVTHR
KIRLVKHELDEESCIKCGICERFCPTSAITVEKRNSIDINLNLCMGCTACEKVCPKSAIK
VENEMGEITAENEISLNNDTCINCMVCSEICPVGAIVYEDGLMKLDDKMCIFCGKCEKNC
PVTAIAIKQKNM