Protein Info for MMP_RS07500 in Methanococcus maripaludis S2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 83 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details PF27339: Prd_NiFe_hyd_3_EhaK" amino acids 1 to 74 (74 residues), 32.9 bits, see alignment E=2.9e-12

Best Hits

KEGG orthology group: K14102, energy-converting hydrogenase A subunit K (inferred from 93% identity to mmq:MmarC5_0120)

Predicted SEED Role

"Energy conserving hydrogenase Eha transmembrane protein K2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX94 at UniProt or InterPro

Protein Sequence (83 amino acids)

>MMP_RS07500 hypothetical protein (Methanococcus maripaludis S2)
MKQYIQLLSIAGFVVLGMIVLINMLQYPITPILGLFVVLLVGILALLIQNKKITHLIETT
EHLMMLAVLIAFIYLGYFAFIAG