Protein Info for MMP_RS07390 in Methanococcus maripaludis S2

Annotation: cell division protein FtsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00065: cell division protein FtsZ" amino acids 23 to 344 (322 residues), 427.9 bits, see alignment E=1.8e-132 PF00091: Tubulin" amino acids 37 to 197 (161 residues), 171.9 bits, see alignment E=1.9e-54 PF12327: FtsZ_C" amino acids 245 to 338 (94 residues), 113.6 bits, see alignment E=4.3e-37

Best Hits

Swiss-Prot: 70% identical to FTSZ1_METJA: Cell division protein FtsZ 1 (ftsZ1) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 100% identity to mmp:MMP1436)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXB6 at UniProt or InterPro

Protein Sequence (360 amino acids)

>MMP_RS07390 cell division protein FtsZ (Methanococcus maripaludis S2)
LKFLKNIAQTDFLEPASEQLSDIDRELLELIEQSKARITVVGCGGAGNNAINRLIAESID
GARIVAINTDAQQLVKTHADHKVLIGKNLTKGLGAGGNPVKGEESAKENSEEVKKAVQDS
DLVFVTCGLGGGTGTGSAPVVAEISKKVGALTVAVVTLPFSMEGKVRMSNAIEGLNKLKE
VADTIVIIPNDKLLEIVQNVPLRTAFKVADEVLMNSVRGMVELVNNAGDIHVDFADVRAV
MNNGGIAMMGIGESDSEKRAREAIQIALNSPLLCVDVDGATGALIHITGPEDMSLEEAKE
IVSTVSDRLDEKATIIWGTTIDETLENSLRVLLIVTGTKSTGDYTVDVTKKRYLIDIPKI