Protein Info for MMP_RS07380 in Methanococcus maripaludis S2

Annotation: transcription elongation factor Spt5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF03439: Spt5-NGN" amino acids 1 to 80 (80 residues), 78.1 bits, see alignment E=3.9e-26 TIGR00405: transcription elongation factor Spt5" amino acids 3 to 145 (143 residues), 202.4 bits, see alignment E=1.6e-64 PF00467: KOW" amino acids 91 to 122 (32 residues), 32.8 bits, see alignment 4.5e-12

Best Hits

Swiss-Prot: 66% identical to SPT5_METJA: Transcription elongation factor Spt5 (spt5) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 100% identity to mmp:MMP1434)

Predicted SEED Role

"Putative transcription antitermination protein NusG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXB8 at UniProt or InterPro

Protein Sequence (146 amino acids)

>MMP_RS07380 transcription elongation factor Spt5 (Methanococcus maripaludis S2)
MIFAVRTTTGQEKNVAESLASRAEKENLEVFSILATEDLKGYILIEAANKGALDELVRKS
FKVKGIVPGETSVNELDHLLTPTKIIEHIDKGDVVELVGGPFKGERARVTRVDKHKEEIT
LELIDAAVPIPITVGIEQVKIISKQD