Protein Info for MMP_RS07365 in Methanococcus maripaludis S2

Annotation: 2-phosphoglycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03477: ATP-cone
  • amino acids 11 to 90 (80 residues), 40.3 bits, E=3.8e-14
• PF13238: AAA_18
  • amino acids 97 to 249 (153 residues), 35.3 bits, E=1.6e-12

Best Hits

Swiss-Prot: 100% identical to PGK2_METMP: 2-phosphoglycerate kinase (pgk2) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K05715, 2-phosphoglycerate kinase [EC: 2.7.2.-] (inferred from 100% identity to mmp:MMP1431)

MetaCyc: 46% identical to 2-phosphoglycerate kinase monomer (Methanothermus fervidus)
RXN-20987 [EC: 2.7.2.16]

Predicted SEED Role

"2-phosphoglycerate kinase (EC 2.7.2.-) (2PGK)" (EC 2.7.2.-)

MetaCyc Pathways

• cyclic 2,3-bisphosphoglycerate biosynthesis (1/2 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.-

Use Curated BLAST to search for 2.7.2.- or 2.7.2.16

Sequence Analysis Tools

See Q6LXC1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>MMP_RS07365 2-phosphoglycerate kinase (Methanococcus maripaludis S2)
MTFDDNIRILVKDKEYDMPFSKGLLARSLTAAGMKPSASYTLARDIERELNEQNVLKISK
DELRRRVYYTLINRDYEAIAEKYLLWRRILKKHSIIILVGGSSGVGTSTIAFELASRLGI
PSVIGTDSIREVMRRSISKDLVPMLYESSYTAWTALRKSSWEEQDSKEMHLLGFERHVEP
VLLGIESIIDRSLTEGTSVIIEGTHIVPGLMAEKYQEMPNVIFLNLTLSSEETHKKRFIA
RAKVSDRPLERYLENFEIIKEINQYIVEKSKENNLPVIENVSISDTVQKCLEIVTERFSN
LNDEPIIDSDFY