Protein Info for MMP_RS07360 in Methanococcus maripaludis S2

Annotation: TrkH family potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details amino acids 439 to 462 (24 residues), see Phobius details PF02386: TrkH" amino acids 63 to 257 (195 residues), 88.6 bits, see alignment E=1.7e-29 amino acids 281 to 457 (177 residues), 105.5 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 50% identical to Y1485_METJA: Uncharacterized cation transporter MJ1485 (MJ1485) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to mmp:MMP1430)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXC2 at UniProt or InterPro

Protein Sequence (478 amino acids)

>MMP_RS07360 TrkH family potassium uptake protein (Methanococcus maripaludis S2)
MKIFKKSDISGIFHELGILISTIGFIMLLPSFIGIYFHEPFFYFLFPSLFFMILGLLINK
ITKPISVKLKHAMVISALAWLMASLIGAIPFYIGIEYFSYLDGVFESMSAWTTTGFSIVG
DVESLPRTLQFWRSFEQWIGGVGVLAMVITILSKAGASAYYRAEAREEKIMPSTIGTIKK
IWQIYLLYTTIGICLLYLSGLNLWSALNICMCGISTGGMSISNQSFPFNNFAKIIMTLIM
YIGGVVSFSVHHNVLTGRRVDDIQTKTSIPILFFAAFVITLTSGIDPLDSLFTVVSAMTS
TGFSSVQISSLTNISIAVLIFVMAIGGATGTTTGGIKLIRLVIMAKGFYYRLKEVVSPGN
AIIYKKIGKNQLSDFLILDAFIIAFAYIIHYLFGTLVLISLGYDPFLSVFESVSLVANMG
LSVDIVNHSLHPIAKILGVFSMWVGRLEIIPIYVLIILPLYLKLKDVGKNKISKNRKL