Protein Info for MMP_RS07355 in Methanococcus maripaludis S2

Annotation: transcription factor S

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF02150: Zn_ribbon_RPB9" amino acids 2 to 31 (30 residues), 37 bits, see alignment E=2.5e-13 TIGR01384: transcription factor S" amino acids 3 to 105 (103 residues), 121 bits, see alignment E=1.5e-39 PF01096: Zn_ribbon_TFIIS" amino acids 64 to 102 (39 residues), 65.9 bits, see alignment E=2.3e-22

Best Hits

Swiss-Prot: 85% identical to TFS_METTL: Transcription factor S (tfs) from Methanothermococcus thermolithotrophicus

KEGG orthology group: K03057, transcription elongation factor (inferred from 98% identity to mmx:MmarC6_1244)

Predicted SEED Role

"Transcription factor S"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXC3 at UniProt or InterPro

Protein Sequence (105 amino acids)

>MMP_RS07355 transcription factor S (Methanococcus maripaludis S2)
MVEFCPKCNNIMLPKGGVLKCVVCKHEEELGDANQEYALKEKIESKKQDVTVIENVDTLP
TTRIECPNCGNMEAFWWLQQTRCADEPETRFYKCKKCSHTWREYD