Protein Info for MMP_RS07340 in Methanococcus maripaludis S2

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 2 to 195 (194 residues), 139.5 bits, E=5e-45
• PF00692: dUTPase
  • amino acids 99 to 171 (73 residues), 28.1 bits, E=1.5e-10

Best Hits

Swiss-Prot: 100% identical to DCDB_METMP: dCTP deaminase, dUMP-forming (dcd) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to mmp:MMP1426)

MetaCyc: 74% identical to dCTP deaminase (dUMP-forming) monomer (Methanocaldococcus jannaschii)
dCTP deaminase (dUMP-forming). [EC: 3.5.4.30]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.30) (dUMP-forming)" (EC 3.5.4.30)

MetaCyc Pathways

• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (8/14 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13 or 3.5.4.30

Sequence Analysis Tools

See Q6LXC6 at UniProt or InterPro

Protein Sequence (206 amino acids)

>MMP_RS07340 dCTP deaminase (Methanococcus maripaludis S2)
MILSDKDIFNYVTSKRVLIEPFNSKFVGPCSYDVTLGSEFIKYNEDVYDVKKTLNHSKFK
IENSVMVCPLNHHLDETIIKNYKEKYNVDCVVSGGLLGTTNEYVELPNDVCAQYQGRSSF
GRVFLQTHQTAGWIDSGFKGKITLEIVAYDKPVILYKNQRVGQLIFSKTLSPADIGYSDR
KCSKYAGQTSVMASLIKKDFETNEEE