Protein Info for MMP_RS07320 in Methanococcus maripaludis S2

Annotation: preprotein translocase subunit SecY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 28 to 429 (402 residues), 331.1 bits, see alignment E=4.8e-103 PF00344: SecY" amino acids 73 to 421 (349 residues), 234.1 bits, see alignment E=1.3e-73

Best Hits

Swiss-Prot: 87% identical to SECY_METVA: Protein translocase subunit SecY (secY) from Methanococcus vannielii

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 100% identity to mmp:MMP1422)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXD0 at UniProt or InterPro

Protein Sequence (442 amino acids)

>MMP_RS07320 preprotein translocase subunit SecY (Methanococcus maripaludis S2)
LESFLLKIKPILELIPEVKRPLREISFKEKLQWTALVLVLYFILGTIDIYTGGSEMPAIF
DFWQTVTASKMGTLITLGIGPIVTAGIIMQLLVGSELISLDLSKPMNRALFQGLQKLFGI
ALCFLEALMFVGAGAFGALTPLMTAVLVFQLALGAILIIYLDEIVSRYGIGSGIGLFIAA
GVSQTIFVGTFGAEGYLWKFFTAMTAGSLWTALEYILPILGTILVFLVVVYVESIRVEIP
LAHGRVKGAVGKYPIKFIYVSNLPVILAAALFANIQLWGMFLEKMGFPILGHYTSGRAVD
GLAYYFSTPYGISSLTADPLHAVFYTVMMVIFCILFGLFWVETSGLDAKSMAKKLGNLDM
AIKGFRKSQKSIEQRLKRYITPITVMGSAFVGFLAAAADFTGALGGGTGVLLTVSIVYRL
YEQLVQEQLSELHPSIAKFIRK