Protein Info for MMP_RS07290 in Methanococcus maripaludis S2

Annotation: 50S ribosomal protein L19e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF01280: Ribosomal_L19e" amino acids 2 to 53 (52 residues), 79.8 bits, see alignment E=1.1e-26 PF25476: Ribosomal_L19e_C" amino acids 55 to 144 (90 residues), 108.4 bits, see alignment E=1.7e-35

Best Hits

Swiss-Prot: 97% identical to RL19E_METVA: 50S ribosomal protein L19e (rpl19e) from Methanococcus vannielii

KEGG orthology group: K02885, large subunit ribosomal protein L19e (inferred from 99% identity to mmz:MmarC7_0662)

Predicted SEED Role

"LSU ribosomal protein L19e" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXD5 at UniProt or InterPro

Protein Sequence (149 amino acids)

>MMP_RS07290 50S ribosomal protein L19e (Methanococcus maripaludis S2)
MDVSTQRRIAAAVLDCGIDRVWIDPENLEKVKMAITKDDIRLLINDGIIVKKQEKGISSA
RKKEVQEQKRKGKRKGPGSRKGAKGARTPKKEKWMNTIRPLRKMLKELRENEKIERSAYR
KLYRMAKGGAFRSRNHMKLYMKEHGILAE