Protein Info for MMP_RS07250 in Methanococcus maripaludis S2

Annotation: 50S ribosomal protein L14

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 TIGR03673: 50S ribosomal protein uL14" amino acids 3 to 131 (129 residues), 203.2 bits, see alignment E=5.9e-65 PF00238: Ribosomal_L14" amino acids 13 to 131 (119 residues), 130.6 bits, see alignment E=1.5e-42

Best Hits

Swiss-Prot: 100% identical to RL14_METMP: 50S ribosomal protein L14 (rpl14) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02874, large subunit ribosomal protein L14 (inferred from 97% identity to mmz:MmarC7_0654)

Predicted SEED Role

"LSU ribosomal protein L23e (L14p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXE3 at UniProt or InterPro

Protein Sequence (132 amino acids)

>MMP_RS07250 50S ribosomal protein L14 (Methanococcus maripaludis S2)
MKGLGSNIVRSLPNGARLVCADNTGAKELEVIAVKNYVGTVRRLPAGGVGHMVFVSVKKG
TPEMRKQVLPAIIIRQKKEYRRADGTRVKFEDNAAVIVTPEGTPKGSEIKGPVSKEAAER
WPGVSRLAKIIH