Protein Info for MMP_RS07185 in Methanococcus maripaludis S2

Annotation: pyridoxal phosphate-dependent aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 378 to 397 (20 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 48 to 407 (360 residues), 125.3 bits, see alignment E=1.8e-40

Best Hits

Swiss-Prot: 61% identical to Y1479_METJA: Uncharacterized aminotransferase MJ1479 (MJ1479) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1396)

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXF5 at UniProt or InterPro

Protein Sequence (434 amino acids)

>MMP_RS07185 pyridoxal phosphate-dependent aminotransferase (Methanococcus maripaludis S2)
MRTDIVSSGVGELSYEIREIVKVAKKAESSGLEVVWENIGDPIAKGEKLPLWIKEIVSET
TMDDSSYGYCPTRGLLETREFLTDLNNSRNGAQITPDEIVFFNGLGDAITNIYGLMRKEC
RVIGPTPAYSTHSSAEGLYSNCRPVMYELDKDDGWNPDIDDLRNKVKYNPSIASILLINP
GNPTGAVYSKKILSEVVDIANEYDLFILADEIYSNLVYNGKKHNYLSEVLDDVPGISLKG
ISKDLPWPGSRCGWTEFYNTQSDELFKKYTENICKFKMIEVCSTTLPQKVIPKIMSDKRY
NKYLEERKSYYETASKYAYNKMKNIDGLNVNRTDGAFYNTIVLEKEYLNENQSLKIQDSE
LKNYVESISKGIPEDKRFVYYLLASTGICGVPLTSFCSEHNGMRFTLLERDEEKRNWVFE
TIAEKVEEYFNSSN