Protein Info for MMP_RS07180 in Methanococcus maripaludis S2

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 752 PF04851: ResIII" amino acids 15 to 168 (154 residues), 80.3 bits, see alignment E=6.2e-26 PF00270: DEAD" amino acids 18 to 174 (157 residues), 76 bits, see alignment E=1.2e-24 PF21210: RNA_helicase_helical" amino acids 226 to 322 (97 residues), 48.1 bits, see alignment E=4.5e-16 PF00271: Helicase_C" amino acids 339 to 448 (110 residues), 78.7 bits, see alignment E=1.6e-25 PF02732: ERCC4" amino acids 552 to 665 (114 residues), 105.4 bits, see alignment E=9.9e-34 PF14520: HHH_5" amino acids 697 to 744 (48 residues), 40.7 bits, see alignment 1.1e-13 PF12826: HHH_2" amino acids 698 to 746 (49 residues), 41.5 bits, see alignment 4.8e-14 PF00633: HHH" amino acids 716 to 744 (29 residues), 32.5 bits, see alignment (E = 2.1e-11)

Best Hits

KEGG orthology group: K10896, fanconi anemia group M protein [EC: 3.6.4.13] (inferred from 100% identity to mmp:MMP1395)

Predicted SEED Role

"Putative ATP-dependent RNA helicase MJ1505 (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.13

Use Curated BLAST to search for 3.6.1.- or 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXF6 at UniProt or InterPro

Protein Sequence (752 amino acids)

>MMP_RS07180 DEAD/DEAH box helicase (Methanococcus maripaludis S2)
MHVTHPLIKPETIEARIYQQLVVASALKQNTLCVLGTGLGKTAIAALTIAGILSKRNGKV
LIIAPSRPLVDQHFKSMNQFLNIDSEKIVILNGKISPKKREAMWESGKIFIATPQVAEND
IISKILKPSQFSLLIADEAHHTTGNHSYTFVANKFKKKSHVLGLTASPGSNIDRIFEICG
NLGIEHVEIKTEEDPDVSPYVAKVKMRPKRVELPEEFEVNLNLLKNALKDRLRDLKENRV
IHSITVNKSELLGLNKKIMAMDDNIKYEMLRISSEAVKLEHAIEMLETQGKSTFLNYYQK
LLTQNTKSAKEITNDPRFIQAVKNLNELDIEHPKYEKMLEIVKEILKENEKIVIFAQYRD
TVQKIVDLLSENEIEAIMFVGQSNKDGKGMSQKEQAKAIEKFKNEANVLVSTSVSEEGID
ISSVNYVLFYEPVPSEIRMIQRRGRAARGEGGQVIVLIAQKTRDEGYYRAGLAKEKNMKN
ILKNMQATLNKKLKELNEENEEESEKTENKDHYMDLRSVVSSKTSDKLEENKPTKLDKKS
KSGLPNKATIIVDSRERHIGRYLSEKAEVEFKTLEIGDYILSDRVAVERKTAEDFENSII
DKRLFNQVMDLKKYERPLIIIEGNEFVRIHENAIRGMMFSIMIDYQIPIMFSRDIEDTAD
ILVKLAEREQIKEKREIAIRYGKRPMSLKERQKFLVEGLPDVGPVMAENLLDNFNSVENI
FTASEKELTSVDGVGPITAKKIREVVTKKYRE