Protein Info for MMP_RS07160 in Methanococcus maripaludis S2

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00978: aspartate-semialdehyde dehydrogenase" amino acids 3 to 344 (342 residues), 457.7 bits, see alignment E=1.2e-141 PF01118: Semialdhyde_dh" amino acids 4 to 129 (126 residues), 129.7 bits, see alignment E=8.2e-42 PF02774: Semialdhyde_dhC" amino acids 160 to 329 (170 residues), 132.6 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 72% identical to DHAS_METJA: Aspartate-semialdehyde dehydrogenase (asd) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to mmp:MMP1391)

MetaCyc: 72% identical to aspartate-semialdehyde dehydrogenase monomer (Methanocaldococcus jannaschii)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXG0 at UniProt or InterPro

Protein Sequence (348 amino acids)

>MMP_RS07160 aspartate-semialdehyde dehydrogenase (Methanococcus maripaludis S2)
MNIKVGILGATGNVGQRFIQMLENHPVFELEALGASQRSAGKTYKDACYWYQTEPIPEEI
ANATVVSTDPNDKAYEDVDIVFSALPADLAKTLEPEFAKAGKYVFSNASAMRMESDVPLI
VPEVNPEHFGMLDVQKSNRCSDGAIITNPNCSTIGAVISLKPIMDKFGIDLVNITTMQAI
SGAGYSGVPSMAILDNMVPYIGGEEEKMQTEALKILGSIDGNNFKNGNFKIGVSCNRVPV
IDGHTESIFVKTTEEATPEEIAKVMDDFDPLKGLNLPSYAKPIVLREENDRPQPRLDRNT
GNGMSIVVGRVRKDPIFSVKYTALEHNTIRGAAGASVLNAELFVQKYL