Protein Info for MMP_RS07145 in Methanococcus maripaludis S2

Annotation: AmmeMemoRadiSam system protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR04336: AmmeMemoRadiSam system protein B" amino acids 3 to 282 (280 residues), 311 bits, see alignment E=3.1e-97 PF01875: Memo" amino acids 5 to 281 (277 residues), 278.6 bits, see alignment E=2.4e-87

Best Hits

Swiss-Prot: 100% identical to Y1387_METMP: MEMO1 family protein MMP1387 (MMP1387) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06990, (no description) (inferred from 100% identity to mmp:MMP1387)

Predicted SEED Role

"Candidate gene for the hypothesized phosphomevalonate decarboxylase; COG1355, Predicted dioxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61652 at UniProt or InterPro

Protein Sequence (284 amino acids)

>MMP_RS07145 AmmeMemoRadiSam system protein B (Methanococcus maripaludis S2)
MTRNPVVAGMFYPAEYHELLEMIEYCYLNPRGPRELPSKRGKYTKPLGIVSPHAGYIYSG
PVAAHGYKKISENISGEITAIILGPNHTGLGSGIATMKGTWKTPFGDMEIDNEFADRLWK
ECDILDMDENSHLREHSIEVQLPFLKHLEDLNIAKFKFVPISMMMQDYESCIDVGYVIAK
VARELNRKIVIIASTDFSHYEPQEQASKKDAVVIKDILELNDEEIFTDVVTHTISMCGYG
PVIAMVKAMKDLGARTSYLLYYSTSGDVTKDYSEVVGYASLLIK