Protein Info for MMP_RS07140 in Methanococcus maripaludis S2

Annotation: TIGR00341 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 117 to 134 (18 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 236 to 261 (26 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details TIGR00341: TIGR00341 family protein" amino acids 3 to 319 (317 residues), 234.2 bits, see alignment E=1.2e-73 PF04087: DUF389" amino acids 144 to 280 (137 residues), 113.3 bits, see alignment E=4.8e-37

Best Hits

Swiss-Prot: 43% identical to Y678_METJA: Uncharacterized protein MJ0678 (MJ0678) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1386)

Predicted SEED Role

"Uncharacterized protein MJ0678"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXG5 at UniProt or InterPro

Protein Sequence (335 amino acids)

>MMP_RS07140 TIGR00341 family protein (Methanococcus maripaludis S2)
VNVRLIECYVPKKIFAGYEESLGDNLENIIWHSICEESNYTVIRLLTETEHVEKVIDVLS
SKYGGSNFRILVTEPTATIPEIKKEEKVEVEDKTPKRVSRHEIIGKIGDISNLSKEYYSL
LFLAAVVASIGIWLDDVALIIGSMIIAPFLSPMISFTFSIAVMDTSLAKKSLKNLILGIL
TVLVFSFFIGTFIHVSPESPQVASRMNLGLQNIVIALSAGFVGTLSMLIPEISSTVVGVM
IAVALMPPLVAFGLMLGSGYYLESVPILILFIVNIISVNFASASLFYIYGITPYKWWEIE
KARKLSIFTIIFWFSNLLILAGIIMLFGNGTLKII