Protein Info for MMP_RS07085 in Methanococcus maripaludis S2

Annotation: ribonuclease HII

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR00729: ribonuclease HII" amino acids 23 to 229 (207 residues), 244.4 bits, see alignment E=6.1e-77 PF01351: RNase_HII" amino acids 24 to 224 (201 residues), 172.9 bits, see alignment E=4.1e-55

Best Hits

Swiss-Prot: 100% identical to RNH2_METMP: Ribonuclease HII (rnhB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03470, ribonuclease HII [EC: 3.1.26.4] (inferred from 100% identity to mmp:MMP1374)

Predicted SEED Role

"Ribonuclease HII (EC 3.1.26.4)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA replication, archaeal or Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXH7 at UniProt or InterPro

Protein Sequence (242 amino acids)

>MMP_RS07085 ribonuclease HII (Methanococcus maripaludis S2)
MSEDINNNLNNSDNSNGSNEKIIVGLDEAGRGPVLGPMVIASVKIDEKNLYKLNDLELKD
SKQLSKKKREELYIIINEMCDVEKIVIDPETIDKQMEIINLNKIELSAFSKLSNHFIREN
DNISIYIDACSSSEQSFSNQFKAKLINKNVEIIAEHKADENYKIVSAASIIAKVTRDRVI
EEYKETFGEIGSGYPSDPKTKKFLKNYVYENRTLPKIARKSWATSKNLLKEIEESKIFQW
VK