Protein Info for MMP_RS07080 in Methanococcus maripaludis S2

Annotation: formate--phosphoribosylaminoimidazolecarboxamide ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06849: DUF1246
  • amino acids 21 to 143 (123 residues), 157.7 bits, E=1.3e-50
• PF06973: DUF1297
  • amino acids 174 to 360 (187 residues), 284.5 bits, E=3.2e-89

Best Hits

Swiss-Prot: 100% identical to PURP_METMP: 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase (purP) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06863, 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC: 6.3.4.-] (inferred from 100% identity to mmp:MMP1373)

MetaCyc: 77% identical to FAICAR synthetase monomer (Methanocaldococcus jannaschii)
RXN-10066 [EC: 6.3.4.23]

Predicted SEED Role

"Phosphoribosylaminoimidazolecarboxamide formyltransferase [alternate form]" in subsystem De Novo Purine Biosynthesis

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)
• inosine-5'-phosphate biosynthesis II (4/5 steps found)
• inosine-5'-phosphate biosynthesis I (4/6 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.-

Use Curated BLAST to search for 6.3.4.- or 6.3.4.23

Sequence Analysis Tools

See Q6LXH8 at UniProt or InterPro

Protein Sequence (361 amino acids)

>MMP_RS07080 formate--phosphoribosylaminoimidazolecarboxamide ligase (Methanococcus maripaludis S2)
MIPKEEIMGIFEKYNKDEVTIVTVGSHTSLHILKGAKLEGFSTAVITTKDRAIPYKRFGV
ADKFIYVDQFSDISKEEIQQQLRDMNAIIVPHGSFIAYCGLDNVEDTFKVPMFGNRAILR
WEAERDLEGQLLGGSGLRIPKKYGGPDEIDGPVMVKFPGARGGRGYFPCSSVEEFWRKID
EFKAKGVLTEDDVSKAHIEEYVVGANYCIHYFYSPLKDQVELMGIDRRYESSIDGLVRVP
AKDQLELDIDPSYVITGNFPVVIRESLLPQVFDMGDKLVAKAKEEVNPGMLGPFCLQSLC
NENLELVVFEMSARVDGGTNTFMNGSPYSCLYTGEPLSMGQRIAKEIKLALELDMIDKVI
S