Protein Info for MMP_RS07075 in Methanococcus maripaludis S2

Annotation: phosphomannomutase/phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF02878: PGM_PMM_I" amino acids 2 to 112 (111 residues), 84.3 bits, see alignment E=1.3e-27 PF02879: PGM_PMM_II" amino acids 147 to 243 (97 residues), 78.4 bits, see alignment E=1.1e-25 PF02880: PGM_PMM_III" amino acids 248 to 356 (109 residues), 64.3 bits, see alignment E=2.3e-21 PF00408: PGM_PMM_IV" amino acids 361 to 435 (75 residues), 47.4 bits, see alignment E=3.3e-16

Best Hits

Swiss-Prot: 68% identical to MANB_METJA: Phosphomannomutase (manB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to mmp:MMP1372)

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXH9 at UniProt or InterPro

Protein Sequence (437 amino acids)

>MMP_RS07075 phosphomannomutase/phosphoglucomutase (Methanococcus maripaludis S2)
LVFKAYDIRGIYEKDLDDNFAYSLGKLVGKKYERIMVGNDIRIGSKKLLKPFIYGILENS
KVYYAGEISTPLMYFGTLKKFDLGVILTASHNPKEYTGFKMCDIDAIPLSPVDEIKPDFE
MFELSEEQKEEIENLDLERLNVDILSEYLNFFTQKLEKTNRKIAVDFANGATTNAEKQVL
KKVLENKIFVNDFPDGNFPAHEPDTLKKECLIDIINSVKSNSCEFGLIFDGDGDRIGMVD
EKGEILAGDILTAIISNEILNEVKGKIVYDLRCSKVVPETISKNGGTPVKTRVGHYFIKK
LMHEIDAEFAGEFSNHFYFKSTGYFESPLLALNYILKAIEREGKPLSEISKNYKKYFHSG
EINFKVADQKKSIESIEKKYENICKIEKLDGISLYCNDFWFNVRSSNTEPLLRLNLEAED
EKTMNEKLTEIKEIINS