Protein Info for MMP_RS07060 in Methanococcus maripaludis S2

Annotation: elongation factor EF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 TIGR00490: translation elongation factor aEF-2" amino acids 3 to 727 (725 residues), 1292.9 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 19 to 255 (237 residues), 191.3 bits, see alignment E=3.9e-60 TIGR00231: small GTP-binding protein domain" amino acids 20 to 158 (139 residues), 67.1 bits, see alignment E=1.6e-22 PF22042: EF-G_D2" amino acids 291 to 374 (84 residues), 51.2 bits, see alignment E=3.4e-17 PF03144: GTP_EFTU_D2" amino acids 306 to 373 (68 residues), 51.2 bits, see alignment E=4.1e-17 PF14492: EFG_III" amino acids 390 to 463 (74 residues), 76.9 bits, see alignment E=3e-25 PF03764: EFG_IV" amino acids 520 to 625 (106 residues), 80.2 bits, see alignment E=3.4e-26 PF00679: EFG_C" amino acids 627 to 712 (86 residues), 89.5 bits, see alignment E=3.5e-29

Best Hits

Swiss-Prot: 100% identical to EF2_METMP: Elongation factor 2 (fusA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03234, elongation factor 2 (inferred from 100% identity to mmp:MMP1369)

Predicted SEED Role

"Translation elongation factor 2" in subsystem Translation elongation factor G family or Translation elongation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXI2 at UniProt or InterPro

Protein Sequence (727 amino acids)

>MMP_RS07060 elongation factor EF-2 (Methanococcus maripaludis S2)
MGRRAKMVEKVKTLMETHEQIRNMGICAHIDHGKTTLSDNLLAGAGMISKELAGDQLALD
FDEEEAARGITIYAANVSMVHEYSGKEYLINLIDTPGHVDFGGDVTRAMRAIDGAVVVCC
AVEGVMPQTETVLRQALKEKVKPVLFINKVDRLINELKLTPEELQGRFMKIIAEVNKLIE
KMAPEEFKKEWLCDVANGKVAFGSAYNNWAISVPYMQRSGISFKDIIDYCEQENQKELAE
KAPLHEVVLDMSIKHLPNPLTAQKYRIPNIWKGDAESTIGKSMVACDPNGPLAGVVTKII
VDKHAGAISACRLFSGRIKQGDDLYLVGSKQKARAQQVSIFMGAERVQVPSISAGNICAL
TGLREATAGETVCSPSEILEPGFESLSHTSEPVITVAIEAKNTKDLPKLIEILRQIARED
NTVRVEINEETGEHLISGMGELHIEVITNTKIGRDGGIEVDVGEPIVVYRETIMGTSPEI
EGKSPNKHNKLYMIAEPMEESVYAAYVEGKLHDEDYKKKTTADGEARLVEAGLEKDQAKK
VMSIYNGNMIVNMTRGIVQLDEARELIIEGFKEGVRNGPLAAEKVQGVKIRLVDATFHED
AIHRGPAQIIPAVRFGVRDAVAQAKPVLLEPMQSVYINTPQDYMGDGMKEINNRRGQILD
MEQEGDMSIIKSSVPVAEMFGFAGAIRGATQGRCLWSVEFSGFERVPNELQPKIAKQIRD
RKGLKSE