Protein Info for MMP_RS07055 in Methanococcus maripaludis S2

Annotation: 30S ribosomal protein S7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR01028: ribosomal protein uS7" amino acids 2 to 188 (187 residues), 280.6 bits, see alignment E=2.6e-88 PF00177: Ribosomal_S7" amino acids 24 to 188 (165 residues), 136.8 bits, see alignment E=2.2e-44

Best Hits

Swiss-Prot: 100% identical to RS7_METMP: 30S ribosomal protein S7 (rps7) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02992, small subunit ribosomal protein S7 (inferred from 100% identity to mmp:MMP1368)

Predicted SEED Role

"SSU ribosomal protein S5e (S7p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXI3 at UniProt or InterPro

Protein Sequence (188 amino acids)

>MMP_RS07055 30S ribosomal protein S7 (Methanococcus maripaludis S2)
LEIKLFGKWDSETVAVKDPSLKSYISVAPVLVPHTAGRNSKKSFDKSKMNIVERLANKLM
ANQNNTGKKHETLAIVEEALTIIENRTKENPVQVLVDALENSGPREETTRISYGGIAFLQ
SVDVSPSRRLDTAFRNIALGASESAHKNKKTVAQCLADELIFASKADMQKSFAVKKKEEK
ERVAQSAR