Protein Info for MMP_RS06990 in Methanococcus maripaludis S2

Annotation: CatB-related O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00132: Hexapep" amino acids 129 to 164 (36 residues), 40.9 bits, see alignment 1.1e-14 PF14602: Hexapep_2" amino acids 130 to 164 (35 residues), 35.6 bits, see alignment 6.3e-13

Best Hits

Swiss-Prot: 53% identical to CAT4_AGRFC: Chloramphenicol acetyltransferase (cat) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00638, chloramphenicol O-acetyltransferase [EC: 2.3.1.28] (inferred from 100% identity to mmp:MMP1355)

Predicted SEED Role

"Chloramphenicol acetyltransferase (EC 2.3.1.28)" (EC 2.3.1.28)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXJ5 at UniProt or InterPro

Protein Sequence (226 amino acids)

>MMP_RS06990 CatB-related O-acetyltransferase (Methanococcus maripaludis S2)
LNSNPFESYRDIKIMNENPKYPVKGEGITREKIKSENVEIGEYTYYSGYYEGKNFKDCIM
YLDEIDNCKDMDKLIIGKFCSIATGVKFIMGGNQGHRYDWISTYPLTLISETPEDLKCEN
GKGYLKKGDTIIENDVWIGANVTIMPGVKIGSGAVIATGSIVTKNVEPYTIVGGNPAKII
KKRFSDEKIELLLKIKWWDWPIEKIKSHINTLMSDDFEELKKICEE