Protein Info for MMP_RS06985 in Methanococcus maripaludis S2

Annotation: tRNA 4-thiouridine(8) synthase ThiI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF22025: ThiI_fer" amino acids 4 to 76 (73 residues), 61.4 bits, see alignment E=2.3e-20 TIGR00342: tRNA sulfurtransferase ThiI" amino acids 5 to 372 (368 residues), 387.3 bits, see alignment E=3.9e-120 PF02926: THUMP" amino acids 84 to 166 (83 residues), 55.3 bits, see alignment E=1.8e-18 PF02568: ThiI" amino acids 179 to 371 (193 residues), 228.1 bits, see alignment E=2e-71 PF03054: tRNA_Me_trans" amino acids 183 to 222 (40 residues), 22.7 bits, see alignment 1.7e-08

Best Hits

Swiss-Prot: 54% identical to THII_METJA: Probable tRNA sulfurtransferase (thiI) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03151, thiamine biosynthesis protein ThiI (inferred from 100% identity to mmp:MMP1354)

Predicted SEED Role

"tRNA S(4)U 4-thiouridine synthase (former ThiI)" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXJ6 at UniProt or InterPro

Protein Sequence (383 amino acids)

>MMP_RS06985 tRNA 4-thiouridine(8) synthase ThiI (Methanococcus maripaludis S2)
LKKFIVRYGEIGTKSRQTMHRFEKLLAKNISKLAKKHGISAEVEIIHTRLIVDVPEENFE
KMKELLKKVPGIVSFSPCYYIDPDIEQIKKISSELFEKEIERYENKENITFRVKTQRPQK
KFPLTSLEVNMEVGGPISEKYGIKVDLKNPTISLDIEVFNEYAYVFAKRIEGIGGIPVGT
QGKVIVLLSDGIDSPVSAYMMAKRGCKLLLLHMKTSDEGLEKTQKLVDVLSDFDPEAKFV
YVDFNEELAKIKAELTEINRDKYTCLYCKKYMLKLAEKHAKWHKCDAIVNGDNMGQVASQ
TLKNLRVISEGIDYPILRPLIGLDKVEIMDIARKIGTFDISTSKEVSCFAVPKHPITNAT
PDEMEKIEEQLLNLRNCKTCKNC