Protein Info for MMP_RS06975 in Methanococcus maripaludis S2

Annotation: sulfide-dependent adenosine diphosphate thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR00292: thiazole biosynthesis enzyme" amino acids 9 to 259 (251 residues), 341.8 bits, see alignment E=1e-106 PF01946: Thi4" amino acids 13 to 241 (229 residues), 277 bits, see alignment E=4.2e-86 PF01494: FAD_binding_3" amino acids 29 to 62 (34 residues), 36.1 bits, see alignment 1.8e-12 PF01266: DAO" amino acids 31 to 74 (44 residues), 32.6 bits, see alignment 2.6e-11 PF07992: Pyr_redox_2" amino acids 31 to 127 (97 residues), 29.4 bits, see alignment E=2.3e-10 PF00890: FAD_binding_2" amino acids 31 to 68 (38 residues), 26.8 bits, see alignment 1.3e-09 PF12831: FAD_oxidored" amino acids 31 to 176 (146 residues), 39.3 bits, see alignment E=2.2e-13 PF13450: NAD_binding_8" amino acids 34 to 66 (33 residues), 33.5 bits, see alignment 1.7e-11

Best Hits

Swiss-Prot: 100% identical to THI4_METMP: Thiamine thiazole synthase (thi4) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03146, thiamine biosynthetic enzyme (inferred from 100% identity to mmp:MMP1352)

MetaCyc: 73% identical to sulfide-dependent adenosine diphosphate thiazole synthase (Methanocaldococcus jannaschii)
RXN-19351 [EC: 2.4.2.59]

Predicted SEED Role

"Thiazole biosynthetic enzyme Thi4 / Ribose 1,5-bisphosphate or 5-ribose-1,2-cyclic phosphate dehydrogenase" in subsystem Calvin-Benson cycle or Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXJ8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>MMP_RS06975 sulfide-dependent adenosine diphosphate thiazole synthase (Methanococcus maripaludis S2)
MDGKLRADEVAVTKSILKSTFDMWMDLIDVDVVIVGAGPSGLTAAKYLAQNGVKTVVLER
HLSFGGGTWGGGMGFPNIVVEKPADEILREAGIKLDEVIGEPELFTADSVEVPAKLGVAA
IDAGAKILTGIVVEDLILKEDKVSGVVIQSYSIEKAGLHIDPITISAKYVIDSTGHDASV
INTLARKNKDLGIEVPGEKSMWADKGENSLTRNTREVFPGLYVCGMAANAYHAGYRMGAI
FGGMYLSGKKCAELILEKLENK