Protein Info for MMP_RS06960 in Methanococcus maripaludis S2

Annotation: NAD+ synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00552: NAD+ synthetase
  • amino acids 9 to 252 (244 residues), 266.6 bits, E=8.9e-84
• PF02540: NAD_synthase
  • amino acids 13 to 251 (239 residues), 293.1 bits, E=1.9e-91

Best Hits

Swiss-Prot: 67% identical to NADE_META3: NH(3)-dependent NAD(+) synthetase (nadE) from Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 100% identity to mmp:MMP1349)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

• aspartate superpathway (18/25 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis I (3/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (3/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (1/5 steps found)
• NAD salvage pathway I (PNC VI cycle) (1/7 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

See Q6LXK1 at UniProt or InterPro

Protein Sequence (258 amino acids)

>MMP_RS06960 NAD+ synthase (Methanococcus maripaludis S2)
MMRTNEQLEELANNICDFIREQVENADAKGVVVGLSGGIDSALVAYLSVMALGKNRVFGV
IMPEKNSNPDDEKYGKLVAESLGIEYDVFDITPVLVAFGAGGYVEGKEFDKRVDSNLKPR
IRMTEVYYHANKKNYLVAGTSNKSEIYMGYGTKYGDLGSDFLTIGNLFKTEVRQLAGYVG
VPKEIIDKAPSAGLWEGQTDEDELGISYETLDKLLNLMEKGKEIDDICEFLSIPPEKVGE
LMLRISTNKHKSLPLPMP