Protein Info for MMP_RS06910 in Methanococcus maripaludis S2

Annotation: RlmF-related methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF05971: Methyltransf_10" amino acids 18 to 177 (160 residues), 53.1 bits, see alignment E=1.3e-17 PF10294: Methyltransf_16" amino acids 83 to 164 (82 residues), 30.1 bits, see alignment E=1.6e-10 PF05175: MTS" amino acids 84 to 174 (91 residues), 33.2 bits, see alignment E=1.6e-11 PF13847: Methyltransf_31" amino acids 88 to 165 (78 residues), 30.3 bits, see alignment E=1.4e-10 PF06325: PrmA" amino acids 88 to 163 (76 residues), 33.3 bits, see alignment E=1.5e-11 PF13649: Methyltransf_25" amino acids 90 to 164 (75 residues), 33.3 bits, see alignment E=2.6e-11 PF08241: Methyltransf_11" amino acids 91 to 164 (74 residues), 26.2 bits, see alignment E=4.1e-09

Best Hits

Swiss-Prot: 56% identical to Y046_METJA: Putative methyltransferase MJ0046 (MJ0046) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1339)

Predicted SEED Role

"UPF0049 protein MJ0046, possible RNA methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXL1 at UniProt or InterPro

Protein Sequence (264 amino acids)

>MMP_RS06910 RlmF-related methyltransferase (Methanococcus maripaludis S2)
MKHEPLELGLKIEDAILVNEKLKDFVVYKSGKPRIDFKNKEAMKEYNIAILGHVFGLDMD
FHEDALIPTPINRYLFIKNIFDEKDDIKDVLEIGTGSGIISILIAKYFECNVTATDTVSD
YLKIAKDNISKNNLTSKINLIDSKGKIIFDIPELKNKKFDLIISYPPYYADNSVASKRSF
GGAFASEVELIGGGAYGEVFSQKIIEEGMDHLNNGGIVAIMFPEKPFERRKFVEDKILEL
GLTLEKSEITTGKRIRHIIKAKKE