Protein Info for MMP_RS06900 in Methanococcus maripaludis S2

Annotation: coenzyme F420-reducing hydrogenase FrhD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00130: coenzyme F420-reducing hydrogenase, FrhD protein" amino acids 7 to 159 (153 residues), 171.2 bits, see alignment E=1.6e-54 TIGR00072: hydrogenase maturation protease" amino acids 11 to 157 (147 residues), 134.3 bits, see alignment E=3.3e-43 PF01750: HycI" amino acids 28 to 156 (129 residues), 113.1 bits, see alignment E=4.3e-37

Best Hits

Swiss-Prot: 54% identical to Y253_METJA: Putative hydrogenase maturation protease MJ0253 (MJ0253) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00442, coenzyme F420 hydrogenase delta subunit (inferred from 100% identity to mmp:MMP1337)

Predicted SEED Role

"Hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Membrane-bound Ni, Fe-hydrogenase (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXL3 at UniProt or InterPro

Protein Sequence (160 amino acids)

>MMP_RS06900 coenzyme F420-reducing hydrogenase  FrhD protein (Methanococcus maripaludis S2)
MIPDSLKYEILVFGCGNLIFADDGFGYEVISKLEKMELPENVGIIDAGTGAPYYLMSLMD
EECNTKKIIIVDIIDFQLPPGTLKILSTEDLTKIDKYTFDAHDMPLSDYLIKAKESGIDV
TVIGCQAKRVTMPDIEVGLTDEVKASLDDAVKLVLEKINE