Protein Info for MMP_RS06895 in Methanococcus maripaludis S2

Annotation: selenocysteine-specific translation elongation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR00231: small GTP-binding protein domain" amino acids 4 to 169 (166 residues), 73 bits, see alignment E=2.5e-24 PF00009: GTP_EFTU" amino acids 5 to 173 (169 residues), 138.7 bits, see alignment E=3.4e-44 TIGR00475: selenocysteine-specific translation elongation factor" amino acids 6 to 304 (299 residues), 367.9 bits, see alignment E=1e-113 PF01926: MMR_HSR1" amino acids 8 to 120 (113 residues), 38.9 bits, see alignment E=1.7e-13 PF03144: GTP_EFTU_D2" amino acids 200 to 267 (68 residues), 53.8 bits, see alignment E=4.3e-18 PF21440: aSelB_III" amino acids 273 to 380 (108 residues), 201.5 bits, see alignment E=4.6e-64

Best Hits

Swiss-Prot: 62% identical to SELB_METJA: Selenocysteine-specific elongation factor (selB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03231, elongation factor 1-alpha (inferred from 100% identity to mmp:MMP1336)

Predicted SEED Role

"Selenocysteine-specific translation elongation factor" in subsystem Selenocysteine metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXL4 at UniProt or InterPro

Protein Sequence (468 amino acids)

>MMP_RS06895 selenocysteine-specific translation elongation factor (Methanococcus maripaludis S2)
MDFKNINLGIFGHIDHGKTTLSKVLTEIASTSAHDKLPESQKRGITIDIGFSAFKLENYR
ITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITK
SDNAGTEEIKRTEMIMKSILQSTQNLKNSSIIPISAKTGFGVEELKNLIINTLNNAEIIR
NTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQCFKESVM
EAKAGDRVGMAIQGVESKQIYRGCILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVH
LNVGMLIVPAVAVPFKKVTFGKSEENVILNEVISGNECYCAFELEEKVLAEVGDRVLITR
LDLPPTTLRICGHGLIEEFKPINDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAADKLI
GEEISIDGKDVVGKIKGTFGTKGLLTAEFSGTVENRDKVILNRLRRWG