Protein Info for MMP_RS06875 in Methanococcus maripaludis S2

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 2 to 36 (35 residues), 29.9 bits, 1.9e-10
• PF07992: Pyr_redox_2
  • amino acids 2 to 214 (213 residues), 103.2 bits, E=8.2e-33
• PF00890: FAD_binding_2
  • amino acids 3 to 30 (28 residues), 21.9 bits, see alignment (E = 4.1e-08)
• PF13450: NAD_binding_8
  • amino acids 4 to 40 (37 residues), 36.6 bits, 2.1e-12
• PF13738: Pyr_redox_3
  • amino acids 4 to 224 (221 residues), 46 bits, E=2e-15
• PF00070: Pyr_redox
  • amino acids 151 to 203 (53 residues), 34.4 bits, 1.2e-11

Best Hits

Swiss-Prot: 52% identical to Y636_METJA: Uncharacterized protein MJ0636 (MJ0636) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to mmp:MMP1332)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• 2-oxoglutarate decarboxylation to succinyl-CoA (1/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)
• glycine biosynthesis II (1/3 steps found)
• glycine cleavage (1/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (1/3 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See Q6LXL8 at UniProt or InterPro

Protein Sequence (384 amino acids)

>MMP_RS06875 FAD-dependent oxidoreductase (Methanococcus maripaludis S2)
MIAVVGGGPAGLSCAHALAKRGLDVEIYEMDKLGGTCLNYGCRYVNALKEVADIIDNLNA
ITGKKHDLEDVISLDELHEKVYKIHKSMRENAKKTLEKKGIFVKFEEFKEDYEKNYDYVV
YATGQNYAKNYLGVECATHRELPYLKKLPKKILIIGGGTVAAEYASIFSIFGSEVTVYAR
SKFLKKIKDDEVRDYIINDLSNFKITHDEEEMKKMLYNDEYFNILAIGGKKRYETNEYFQ
VLGKSKVYACGDSVRGGYTPIANREGRIVAENIFNEINNHPLKKMDYGVEVATIRMPINI
SVVGKQTNDFKTSYNRPGTGYYFKKAEKRGMNRIYYENGKAVGAVVMTNATELAPYFAQY
LKGIEVYKDFVEVYPTTDPFYWQF