Protein Info for MMP_RS06865 in Methanococcus maripaludis S2

Annotation: HypC/HybG/HupF family hydrogenase formation chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01455: HupF_HypC
  • amino acids 1 to 69 (69 residues), 76.6 bits, E=6.5e-26
• TIGR00074: hydrogenase assembly chaperone HypC/HupF
  • amino acids 1 to 80 (80 residues), 90.6 bits, E=2.3e-30

Best Hits

Swiss-Prot: 73% identical to Y200_METJA: Uncharacterized hydrogenase expression/formation protein MJ0200 (MJ0200) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04653, hydrogenase expression/formation protein HypC (inferred from 99% identity to mmz:MmarC7_0575)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypC" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

See Q6LXM0 at UniProt or InterPro

Protein Sequence (88 amino acids)

>MMP_RS06865 HypC/HybG/HupF family hydrogenase formation chaperone (Methanococcus maripaludis S2)
MCLAIPSVVIDIFEEDGEKYALAEYKGVKQKAKLALIEGVEIGDYVLIHTGYALEKMSED
EAKLSLDAWEELFDVLDEMDGVKKENSE