Protein Info for MMP_RS06775 in Methanococcus maripaludis S2

Annotation: 2-oxoacid:ferredoxin oxidoreductase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02175: 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  • amino acids 4 to 175 (172 residues), 83.2 bits, E=9.7e-28
• PF01558: POR
  • amino acids 11 to 175 (165 residues), 132.6 bits, E=8.4e-43

Best Hits

Swiss-Prot: 72% identical to KORC_METJA: 2-oxoglutarate synthase subunit KorC (korC) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00177, 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [EC: 1.2.7.3] (inferred from 100% identity to mmp:MMP1315)

MetaCyc: 100% identical to 2-oxoglutarate ferredoxin oxidoreductase gamma subunit (Methanococcus maripaludis)
2-oxoglutarate synthase. [EC: 1.2.7.3]

Predicted SEED Role

"2-oxoglutarate oxidoreductase, gamma subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

• incomplete reductive TCA cycle (6/7 steps found)
• reductive TCA cycle I (6/11 steps found)
• TCA cycle V (2-oxoglutarate synthase) (4/9 steps found)
• reductive TCA cycle II (5/12 steps found)
• TCA cycle VI (Helicobacter) (2/9 steps found)
• TCA cycle VII (acetate-producers) (2/9 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)

KEGG Metabolic Maps

• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

See Q6LXN4 at UniProt or InterPro

Protein Sequence (177 amino acids)

>MMP_RS06775 2-oxoacid:ferredoxin oxidoreductase subunit gamma (Methanococcus maripaludis S2)
MRKEIRFSGFGGQGIILAGVILGRAASLYAGKEAVQTQSYGPEARGGASKSEVVISESEI
DFPKVIQPDILVSMSQPAFDKYGYDLKENAKVIVDRDLVNLPKGYEEKYEVYKVPFTEIA
NKEVGLGIVANIVMLGALTKLAGLVSKEEVEKALLDSIPKGTEKKNLMAFEKGYDYL