Protein Info for MMP_RS06765 in Methanococcus maripaludis S2

Annotation: flap endonuclease-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR03674: flap structure-specific endonuclease" amino acids 1 to 324 (324 residues), 435.3 bits, see alignment E=7.7e-135 PF00752: XPG_N" amino acids 13 to 99 (87 residues), 61.5 bits, see alignment E=9.1e-21 PF00867: XPG_I" amino acids 143 to 224 (82 residues), 94.1 bits, see alignment E=5.6e-31

Best Hits

Swiss-Prot: 64% identical to FEN_META3: Flap endonuclease 1 (fen) from Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)

KEGG orthology group: K04799, flap endonuclease-1 [EC: 3.-.-.-] (inferred from 100% identity to mmp:MMP1313)

Predicted SEED Role

"Flap structure-specific endonuclease (EC 3.-.-.-)" in subsystem DNA Repair Base Excision or DNA replication, archaeal (EC 3.-.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXN6 at UniProt or InterPro

Protein Sequence (324 amino acids)

>MMP_RS06765 flap endonuclease-1 (Methanococcus maripaludis S2)
MGVQFGDLIPKTEISLKFLRNKTVAIDAMNVIYQFLSSIRLRDGSPLKNKNGDITSTYNG
IFYKTIYMLENGMTPIWVFDGKSHELKEKTKEERRKSREGALDSYMEAKEQNNLEEMQKY
AKRANFLDKKTVDNSKKLLELMGIPYVNAPSEGEAQCAELVKANNAFCVISQDYDSILYG
AENVVKNITSSNKDIELIELEKTLSGLNISRDQLIDAAILIGTDYNPGGLKGFGPKKAID
TVKKGKMENYISEIENYSEIRKIFDEPNVTTDYDITLKTPKKDELAEFLIEENDFSKDRI
LPNIEKISNLLGNKKSQKSLEAWF