Protein Info for MMP_RS06735 in Methanococcus maripaludis S2

Annotation: class I SAM-dependent rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF17785: PUA_3" amino acids 4 to 55 (52 residues), 25.2 bits, see alignment 6.4e-09 PF02475: Met_10" amino acids 116 to 289 (174 residues), 42.8 bits, see alignment E=2.9e-14 PF10672: Methyltrans_SAM" amino acids 142 to 292 (151 residues), 45.7 bits, see alignment E=2.7e-15 PF06325: PrmA" amino acids 201 to 282 (82 residues), 32.8 bits, see alignment E=3e-11 PF01728: FtsJ" amino acids 203 to 315 (113 residues), 33.3 bits, see alignment E=2.6e-11 PF05175: MTS" amino acids 207 to 292 (86 residues), 32.2 bits, see alignment E=4.4e-11 PF13847: Methyltransf_31" amino acids 207 to 306 (100 residues), 35.9 bits, see alignment E=3.5e-12 PF03602: Cons_hypoth95" amino acids 207 to 308 (102 residues), 34.7 bits, see alignment E=8.1e-12 PF09445: Methyltransf_15" amino acids 210 to 287 (78 residues), 26.2 bits, see alignment E=3e-09 PF13649: Methyltransf_25" amino acids 211 to 283 (73 residues), 29.4 bits, see alignment E=5.8e-10 PF02005: TRM" amino acids 230 to 285 (56 residues), 29.5 bits, see alignment 2.5e-10

Best Hits

Swiss-Prot: 61% identical to Y1649_METJA: Putative ribosomal RNA large subunit methyltransferase MJ1649 (MJ1649) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to mmp:MMP1307)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXP2 at UniProt or InterPro

Protein Sequence (380 amino acids)

>MMP_RS06735 class I SAM-dependent rRNA methyltransferase (Methanococcus maripaludis S2)
MSFQIDKRAYQSLKNFSNIIYKNAIVNKDDFSKTEEIVDITYNGNFVAKALYDPKFPLIK
ILTRENEEIDKDFFFKRINNANNYRTDILNYKDTYRMIYAEADYLPSIILDKYNKIASIQ
ISSKIMDNYSDLIFECISEITDVETMYVQSGKKGSDVKTKIFGDKSQIETVISEGNAKFN
VNMKGHKTGFFLDQRDNRIDLENYVKPGDKVLDICSYTGGFAVHAGIKGGEVTAVDLSEK
ALAVAEENMELNRVKNYNCMVSNAFDAMKEMIKNNEKFDVVVLDPPAFTDSSKDIKNALN
AYNSMNYLGLKLAKRILVTCSCSHHIDRESFKHTIVSSSLRAKKEIRQIGSYRTQAPDHI
ITMANKDLEYLKCLFFNVVN