Protein Info for MMP_RS06640 in Methanococcus maripaludis S2

Annotation: 50S ribosomal protein L16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00279: ribosomal protein uL16" amino acids 1 to 172 (172 residues), 261.3 bits, see alignment E=1.7e-82 PF00252: Ribosomal_L16" amino acids 13 to 163 (151 residues), 98.4 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 100% identical to RL10E_METMP: 50S ribosomal protein L10e (rpl10e) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02866, large subunit ribosomal protein L10e (inferred from 100% identity to mmp:MMP1289)

Predicted SEED Role

"LSU ribosomal protein L10e (L16p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXR0 at UniProt or InterPro

Protein Sequence (173 amino acids)

>MMP_RS06640 50S ribosomal protein L16 (Methanococcus maripaludis S2)
MALRPARCYRTIERRSYTRKEYVRAVPQPKVVHYVMGNPSAEFPVQVQLVSKSDILIRHN
ALESSRIAGNKYILSECGRTGYLFNIRVYPHEILRENKMAAGAGADRISDGMRLSFGKAV
GTAAKVKKGQEIITIGVNPEKFYAAKEALRRCSMKLPTACKIVVTKGKELIKD