Protein Info for MMP_RS06625 in Methanococcus maripaludis S2

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF13662: Toprim_4" amino acids 170 to 233 (64 residues), 38.2 bits, see alignment E=2.1e-13 PF01751: Toprim" amino acids 171 to 246 (76 residues), 33.2 bits, see alignment E=7.3e-12 PF13155: Toprim_2" amino acids 172 to 233 (62 residues), 26.5 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 100% identical to DNAG_METMP: DNA primase DnaG (dnaG) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1286)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXR3 at UniProt or InterPro

Protein Sequence (436 amino acids)

>MMP_RS06625 DNA primase (Methanococcus maripaludis S2)
MDLGTTKYIIYTELIADGYVEKHDVIGAIFGQTEGLLSNELDLRDLQKSGRIGRIDVELE
NINGKSFAKITLPSSLDKVETSILAATLETIDRVGPCFATVKITEVEDIRVSKRQYITNR
ARSILRKLMDEMIDTYEITEEIKESLRTEEIMEYGPENLPCGPNIIHSDSIIVVEGRADV
LNLLRCGIKNTVAVEGTSVPKSIMELTKKKTTTAFTDGDRGGELILKELLQTCDIDYVAR
APYGKEVEGTSKKELMKCLRAKVPVEQIVGNNCNGSGVIESNTPKEIVEPITPKHFEKVE
TPAVIEPVFKEDAIEEETIIVEPVKKAETEIIDVDATNETQSEKKFSGVKEIVDSIKNTG
NVKFVVDGTEKTNTFKEFLTNIHEIKKMDFFAADMPISQKIVDLLYDKTPIIVGKEINVT
KKPVNLRLFSFDEIVA