Protein Info for MMP_RS06600 in Methanococcus maripaludis S2

Annotation: class III signal peptide-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 67 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details PF04021: Class_IIIsignal" amino acids 11 to 37 (27 residues), 39.8 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 100% identical to Y1283_METMP: UPF0333 protein MMP1283 (MMP1283) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 94% identity to mmq:MmarC5_0310)

Predicted SEED Role

"UPF0333 protein MMP1283"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXR6 at UniProt or InterPro

Protein Sequence (67 amino acids)

>MMP_RS06600 class III signal peptide-containing protein (Methanococcus maripaludis S2)
MSVALKKFFSKRGQLSLEFSVLVLAVITAAILLGYHLIVSSKAVQESNIDTINNTHNTAI
DALSEVS