Protein Info for MMP_RS06595 in Methanococcus maripaludis S2

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF13238: AAA_18" amino acids 4 to 132 (129 residues), 47.7 bits, see alignment E=2.2e-16 PF13207: AAA_17" amino acids 7 to 130 (124 residues), 56.1 bits, see alignment E=4.9e-19

Best Hits

Swiss-Prot: 100% identical to Y1282_METMP: UPF0200 protein MMP1282 (MMP1282) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1282)

Predicted SEED Role

"Dephospho-CoA kinase archaeal, predicted (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.24

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXR7 at UniProt or InterPro

Protein Sequence (183 amino acids)

>MMP_RS06595 flagellar hook-basal body complex protein FliE (Methanococcus maripaludis S2)
MKLIGITGMPGSGKSAITKLAEKYKIVVVSMGDVVRYETLKQGMPLNPENVGNTAVKLRE
IYGKEAIAVPCLNYVNEKYNNEDFVIIEGIRSIYEVNYIKKHAELDIIAIHSSPKTRFER
LSGRNREDDSNDWNTFVERDERELNFSIGRVISLADYMVVNEGNYMDFVNDLENTFKKII
NVN