Protein Info for MMP_RS06575 in Methanococcus maripaludis S2

Annotation: fluoride efflux transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 33 to 55 (23 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details PF02537: CRCB" amino acids 5 to 114 (110 residues), 102.6 bits, see alignment E=6.6e-34 TIGR00494: protein CrcB" amino acids 5 to 116 (112 residues), 115 bits, see alignment E=1.2e-37

Best Hits

Swiss-Prot: 99% identical to CRCB_METMP: Putative fluoride ion transporter CrcB (crcB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06199, CrcB protein (inferred from 99% identity to mmp:MMP1279)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61395 at UniProt or InterPro

Protein Sequence (122 amino acids)

>MMP_RS06575 fluoride efflux transporter CrcB (Methanococcus maripaludis S2)
LREILLIGLGGFFGAILRYLVSGIIPVKFGIPTGTLIVNLLGSFIIGFLIYSSLFGSLST
EYRLFIITGFCGALTTFSTFSYESFTMLEHNYYLKTGLNILLNVFGCLGMVYLGRLASMF
FW