Protein Info for MMP_RS06540 in Methanococcus maripaludis S2

Annotation: 3-methyl-2-oxobutanoate dehydrogenase subunit VorB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF01855: POR_N" amino acids 15 to 204 (190 residues), 178.6 bits, see alignment E=1.7e-56 PF17147: PFOR_II" amino acids 246 to 340 (95 residues), 96 bits, see alignment E=1.6e-31

Best Hits

Swiss-Prot: 75% identical to VORB_METTM: Ketoisovalerate oxidoreductase subunit VorB (vorB) from Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)

KEGG orthology group: K00186, 2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC: 1.2.7.7] (inferred from 100% identity to mmp:MMP1272)

Predicted SEED Role

"Ketoisovalerate oxidoreductase subunit VorB (EC 1.2.7.7)" in subsystem Ketoisovalerate oxidoreductase (EC 1.2.7.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.7

Use Curated BLAST to search for 1.2.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXS6 at UniProt or InterPro

Protein Sequence (351 amino acids)

>MMP_RS06540 3-methyl-2-oxobutanoate dehydrogenase subunit VorB (Methanococcus maripaludis S2)
MATQLVKGNTAVIIGAMYAGCDCYFGYPITPASEVLHEASKYFPMVGRKFVQAESEEAAI
NMVYGAASTGKRVLCATSGPGMSLKQEGISFLAGSELPCVLVNVQRAGPGLGNIGPEQAD
YNQAVKGGGHGNYKNIVLAPNSVQEMCDFTAKAFELSTKYKNPVIVLSDGVLGQMVEPLK
FPEQAIKPEIDESWAVCGTKETRKNLVTSIFLDFKQLEEFNYKLQDKYEIIKENEQDFEG
YMLDDAEIILVSYGISSRISKTAVDVARKEGLKVGLFRPKTLFPFPEKELNKIAEKKCTF
ISVEMSNGQMAEDIKLATCCKRPIELVNRLGGNLIEVDQILDKIKEIAGGN