Protein Info for MMP_RS06530 in Methanococcus maripaludis S2

Annotation: bifunctional hexulose-6-phosphate synthase/ribonuclease regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF00215: OMPdecase" amino acids 8 to 211 (204 residues), 115.3 bits, see alignment E=3.9e-37 PF03737: RraA-like" amino acids 243 to 392 (150 residues), 160.1 bits, see alignment E=4.9e-51

Best Hits

KEGG orthology group: K13831, 3-hexulose-6-phosphate synthase / 6-phospho-3-hexuloisomerase [EC: 4.1.2.43 5.3.1.27] (inferred from 100% identity to mmp:MMP1270)

Predicted SEED Role

"D-arabino-3-hexulose 6-phosphate formaldehyde lyase / Hypothetical protein with distant similarity to Ribonuclease E inhibitor RraA (former MenG)" in subsystem Formaldehyde assimilation: Ribulose monophosphate pathway

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.43 or 5.3.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXS8 at UniProt or InterPro

Protein Sequence (438 amino acids)

>MMP_RS06530 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator (Methanococcus maripaludis S2)
MQFKSELPPVQVALDLVDLPRAINIAKEAVLGGATWVEAGTPLIKSEGMNAIRELRKNFP
TLTIVADMKTMDAGSTEVEMAAKAGANVILILGVGPDSMIKDAVKAGKKYGVLVGTDLIA
TEDPVKRAVELEEMGVDIINIHVGLDQQVLNVDPVELVKRVSENCKKAKIAAAGGLNSET
AVKAYEAGADIIIAGGTLYKSADPEQTARDIVKSLETGKPVKTDKFKKFNEDELGSAFDI
VSTSNISDAMHRTGEMKGLKPVWNSERPLKFAGPAVTVRTYSGDWSKPVSAIDNCEAGNV
LVIDNCSSEIACWGGLATLSCKTKGVVAVVIDGAVRDVEEILKIGIPVYARSITPTAGEP
KGFGEINAVIECAGRTVEPGDWIVGDENGIIVVPKNEAMEIANRAIDVKEREDRVKEEIT
RGTTLAKTIRLKDWELKK