Protein Info for MMP_RS06510 in Methanococcus maripaludis S2

Annotation: Glu-tRNA(Gln) amidotransferase subunit GatD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18195: GatD_N
  • amino acids 1 to 52 (52 residues), 61.1 bits, 7.6e-21
• TIGR02153: glutamyl-tRNA(Gln) amidotransferase, subunit D
  • amino acids 16 to 413 (398 residues), 595 bits, E=6.1e-183
• TIGR00519: L-asparaginase, type I
  • amino acids 73 to 411 (339 residues), 493.1 bits, E=3.6e-152
• PF00710: Asparaginase
  • amino acids 75 to 266 (192 residues), 211.9 bits, E=9.6e-67
• PF17763: Asparaginase_C
  • amino acids 290 to 401 (112 residues), 107.9 bits, E=4.7e-35

Best Hits

Swiss-Prot: 100% identical to GATD_METMP: Glutamyl-tRNA(Gln) amidotransferase subunit D (gatD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09482, glutamyl-tRNA(Gln) amidotransferase subunit D [EC: 6.3.5.7] (inferred from 100% identity to mmp:MMP1266)

Predicted SEED Role

"Glutamyl-tRNA(Gln) amidotransferase asparaginase subunit (EC 6.3.5.7)" in subsystem tRNA aminoacylation, Glu and Gln (EC 6.3.5.7)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)

KEGG Metabolic Maps

• Aminoacyl-tRNA biosynthesis
• Glutamate metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.7

Use Curated BLAST to search for 6.3.5.7

Sequence Analysis Tools

See P61400 at UniProt or InterPro

Protein Sequence (418 amino acids)

>MMP_RS06510 Glu-tRNA(Gln) amidotransferase subunit GatD (Methanococcus maripaludis S2)
MDIGDFVKLELENTTYSGTVMPSLNEDTVVIKMKSGYNVGIDKKKIKNIEILESGDKPKY
GLPPLNLEKNPKLKNISILSTGGTVASRVDYKTGAVHPAFTADDLIRAVPELMDVANIKG
KVILNILSENMLPKYWVMTADAIKEEIENGAEGIVIAHGTDTMHYTASALSFMVNSEVPI
ILVGAQRSSDRPSSDAALNIIAAVKAATEPIKGVYVLMHGETGDTVCHLHEGTKVRKLHS
SRRDAFKSVNETPIAEVNPFTKKVTYLREVKSQDRSKIKEVVLNTNLEEKVALIKVYPGI
DSEILKFYVDNGYKGIILEGTGLGHTPETFFEGIDYANENNVLVAMTTQTINGRVNMNVY
SNGRELQAKGVIPCEDMLSEVAFVKLMHLLGNYEFKEAKELMSKNIAGEINESINLEC