Protein Info for MMP_RS06475 in Methanococcus maripaludis S2

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF07992: Pyr_redox_2" amino acids 1 to 284 (284 residues), 221.9 bits, see alignment E=5.5e-69 PF13738: Pyr_redox_3" amino acids 137 to 276 (140 residues), 42.8 bits, see alignment E=1.9e-14 PF00070: Pyr_redox" amino acids 147 to 224 (78 residues), 71.4 bits, see alignment E=3.2e-23 PF02852: Pyr_redox_dim" amino acids 329 to 425 (97 residues), 73.4 bits, see alignment E=7.7e-24

Best Hits

Swiss-Prot: 64% identical to NAOX_METJA: Putative NADH oxidase (MJ0649) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03885, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 100% identity to mmp:MMP1259)

MetaCyc: 35% identical to NAD(P)H sulfur oxidoreductase (CoA-dependent) (Pyrococcus furiosus)
RXN-14537 [EC: 1.8.1.18]

Predicted SEED Role

"NADH oxidase of the flavin-dependent disulfide reductase family, MJ0649"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.99.3 or 1.8.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXT8 at UniProt or InterPro

Protein Sequence (442 amino acids)

>MMP_RS06475 FAD-dependent oxidoreductase (Methanococcus maripaludis S2)
MDVVIIGSGAGGLTTASNIKKHDKNAKVTVITSDKYIAYSPCAIPYVIGEEIADFDTIIM
HTPKDYKAKGIDVIVEAEVLDVVSGENKVIYKKDGTETELKYDNLVLATGGTPFVPPIEG
VTLDGVFKVRTIEDGQKITEWAKDTKNVVVAGAGAIGIEIAFGLKEIGLDVTVVEMVPQV
FPRALDPDMAETVQKYLEEQGIKIILEKPVGKIIGNDKVEAVLVGEETIPAEMVIMSTGV
RSNIELAKSAGCDIGRWAVLTNEKMQTSIPNIYAVGDCVEVIDAITMQNTLSPFGTTAVR
QGKVAAKAIVKLEAEIKPVLNSMVSKIGKLEIGGTGMTETAAKMNGIEIVLGYSKALTRA
RYYPGGKPIYIKMVADKMTKKVIGCQIISEERVAERVDAMSVAISNGMTVEELANQEFCY
APPVSMVIDPIVFAAEDTLDKF