Protein Info for MMP_RS06455 in Methanococcus maripaludis S2

Annotation: phenylalanine--tRNA ligase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF18262: PhetRS_B1" amino acids 2 to 76 (75 residues), 31.4 bits, see alignment E=4.5e-11 TIGR00471: phenylalanine--tRNA ligase, beta subunit" amino acids 2 to 554 (553 residues), 652.1 bits, see alignment E=3.3e-200 PF03483: B3_4" amino acids 124 to 248 (125 residues), 34.9 bits, see alignment E=3.1e-12 PF03484: B5" amino acids 283 to 346 (64 residues), 61 bits, see alignment E=2.4e-20 PF17759: tRNA_synthFbeta" amino acids 353 to 552 (200 residues), 149.2 bits, see alignment E=3.1e-47 PF01409: tRNA-synt_2d" amino acids 356 to 553 (198 residues), 31.8 bits, see alignment E=2.7e-11

Best Hits

Swiss-Prot: 100% identical to SYFB_METMP: Phenylalanine--tRNA ligase beta subunit (pheT) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01890, phenylalanyl-tRNA synthetase beta chain [EC: 6.1.1.20] (inferred from 100% identity to mmp:MMP1255)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXU2 at UniProt or InterPro

Protein Sequence (554 amino acids)

>MMP_RS06455 phenylalanine--tRNA ligase subunit beta (Methanococcus maripaludis S2)
VPTINVNKVDLERLSNISLSDKLIEDRFPMMGVEVEEIFEEVDKNGKKQNMVQFSINPDR
PDYLSVEGLARGFRGFMGITTGIQEFEVLDSDIKVTVEENETRPYVAFALVKNVLMDEFV
LESMINLQEKLHWAIGRDRKKLAIGIHDFDKVKAPFTYKEIKGDEIKFVPLGYEDEEMTP
REIIEKHEKGIKYAHLIQNDKFPIILDANGEVLSLPPIINGTLTKVTPTSKNLLIDITGT
EKEAVEETLNIIVCALVERRGTIVSVNVNGKKYPDLTPKSRIISVESINKKLGLNLNPGE
IIQALKKSGMDALYEDGNLIVKIPAYRNDILQNVDLKEEIAINYGYEKFDGKLPSVATTG
SKDPVEKKCSAMSDLMIGLGFYEVMNLTLSNQDTLFEKMNLKVDEKDYIEVLKPASIEHR
VLRTSILPLLLETLYINKHNALPQKIFEVGDCVVIDEEDTETDTKCKNIKKIAGAITHPL
TNFNEIKSSTEALLREFFEGFEFENYEHPAFIPGRCAKILKSGKEVGFFGEIHPEVILNF
ELEHPVVGFEITIE