Protein Info for MMP_RS06425 in Methanococcus maripaludis S2

Annotation: formylmethanofuran dehydrogenase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03122: formylmethanofuran dehydrogenase subunit C
  • amino acids 4 to 262 (259 residues), 345.9 bits, E=6.5e-108
• PF01493: GXGXG
  • amino acids 63 to 209 (147 residues), 41.5 bits, E=5.7e-15

Best Hits

Swiss-Prot: 100% identical to FWDC_METMP: Tungsten-containing formylmethanofuran dehydrogenase 2 subunit C (fwdC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00202, formylmethanofuran dehydrogenase subunit C [EC: 1.2.99.5] (inferred from 100% identity to mmp:MMP1249)

Predicted SEED Role

"Formylmethanofuran dehydrogenase (tungsten) subunit C (EC 1.2.99.5)" in subsystem Methanogenesis (EC 1.2.99.5)

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• methanogenesis from H₂ and CO₂ (6/6 steps found)
• methyl-coenzyme M oxidation to CO₂ II (6/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (5/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
• methoxylated aromatic compound degradation II (6/9 steps found)
• superpathway of methanogenesis (11/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.5

Use Curated BLAST to search for 1.2.99.5

Sequence Analysis Tools

See P0CW43 at UniProt or InterPro

Protein Sequence (272 amino acids)

>MMP_RS06425 formylmethanofuran dehydrogenase subunit C (Methanococcus maripaludis S2)
MNELILNLKGDVSVPVEMDKILPEKIQEMSLEEISGIELIQGNKTAKVSEIFDVELKESD
VAKVTINNCCKKVKRIGEKMTSGEIVVNGDAGMYIGVEMKGGKITVNGDAESWVGQNLKG
GEIIINGNAENYVGSAYRGDWRGMSGGKITITGNAGSELGEYLKGGTIVIKGNTKIMPGI
HQNGGMIIIEGDIEGRAGGEMMKGAIVVYGKILEPLPSFKFEGIVEDPLVKLSKKDAGTQ
LKGTFIKFSGDYVNTKPKGQLYAAIENNKNLI