Protein Info for MMP_RS06400 in Methanococcus maripaludis S2

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF13237: Fer4_10" amino acids 92 to 140 (49 residues), 29.3 bits, see alignment E=1.6e-10 PF13187: Fer4_9" amino acids 98 to 143 (46 residues), 28.7 bits, see alignment E=2.7e-10 PF00037: Fer4" amino acids 123 to 145 (23 residues), 30.3 bits, see alignment 6.6e-11

Best Hits

Swiss-Prot: 46% identical to FWDE_METJA: Ferredoxin-type protein FwdE (fwdE) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00204, formylmethanofuran dehydrogenase subunit H [EC: 1.2.99.5] (inferred from 100% identity to mmp:MMP1244)

Predicted SEED Role

"Formylmethanofuran dehydrogenase (tungsten) operon gene H" in subsystem Methanogenesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.5

Use Curated BLAST to search for 1.2.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXV2 at UniProt or InterPro

Protein Sequence (148 amino acids)

>MMP_RS06400 4Fe-4S binding protein (Methanococcus maripaludis S2)
MPEHILSGIKAVVAINMRKEGKLQREIAEFLEMDRSIISHYLHGRYPSDKVMRVSEEIIS
LPKEHGIPLITSLGDNKQITKKLIERIYNITISIDMEKCIACGKCLECEYGAISVYSEDI
GISIDREKCILCCKCVSECPVGALKIVK