Protein Info for MMP_RS06375 in Methanococcus maripaludis S2

Annotation: ATP-dependent sacrificial sulfur transferase LarE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR00268: TIGR00268 family protein" amino acids 10 to 256 (247 residues), 198.2 bits, see alignment E=9e-63 PF02540: NAD_synthase" amino acids 20 to 117 (98 residues), 28.5 bits, see alignment E=8.1e-11 PF06508: QueC" amino acids 23 to 101 (79 residues), 26.6 bits, see alignment E=4.1e-10

Best Hits

Swiss-Prot: 42% identical to Y830_METJA: Uncharacterized protein MJ0830 (MJ0830) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06864, (no description) (inferred from 100% identity to mmp:MMP1239)

Predicted SEED Role

"ATP-utilizing enzyme of the PP-loop superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LXV7 at UniProt or InterPro

Protein Sequence (258 amino acids)

>MMP_RS06375 ATP-dependent sacrificial sulfur transferase LarE (Methanococcus maripaludis S2)
MIIMEKGLLEKYNSLLEFFKNKKVIVAYSGGVDSTLISKIASDNAQTLAVTIDNGFFSEN
VIKKAENRAKKYNIPQKTIKIDYLNEITSKDLENRCYNCKKRIAEELKRIKNELNYDIIV
DGTIYDDIFEDRPGIKAFNESNIISPLSNLKFSKNDVFELSNYLKIDIPKKDTCMATRIL
SAPISKENMAKSNLAEEFIKLNFHIESYLRVRYLENIAIIELTKNESEKIFDNDSIERIN
TELKKIGFEKVVLDLNFK